TA345950 SFRS6 antibody

Rabbit Polyclonal Anti-SFRS6 Antibody

See related secondary antibodies

Search for all "SFRS6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SFRS6

Product Description for SFRS6

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SFRS6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SFRS6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Pre-mRNA-splicing factor SRP55, SRP55, Splicing factor arginine/serine-rich 6
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13247
Immunogen:
The immunogen for anti-SFRS6 antibody: synthetic peptide directed towards the middle region of human SFRS6. Synthetic peptide located within the following region: KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYS.
GeneID:
6431
Application WB
Background SFRS6 is involved in mR splicing and may play a role in the determition of altertive splicing. It belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12.The protein encoded by this gene is involved in mR splicing and may play a role in the determition of altertive splicing. The encoded nuclear protein belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SFRS6 (5 products)

Catalog No. Species Pres. Purity   Source  

SFRS6

SFRS6 Human
  Abnova Taiwan Corp.

SFRS6

SFRS6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SFRS6

SFRS6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SFRS6

SFRS6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SFRS6

SFRS6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn