TA345954 NXF1 antibody

Rabbit Polyclonal Anti-NXF1 Antibody

See related secondary antibodies

Search for all "NXF1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat NXF1

Product Description for NXF1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat NXF1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NXF1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Nuclear RNA export factor 1, TAP, Tip-associated protein, Tip-associating protein, mRNA export factor TAP
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UBU9
Immunogen:
The immunogen for anti-NXF1 antibody: synthetic peptide directed towards the N terminal of human NXF1. Synthetic peptide located within the following region: RPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYG.
GeneID:
10482
Application WB
Background NXF1 is one member of a family of nuclear R export factor. Common domain features of this family are a noncanonical RNP-type R-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. NXF1 shuttles between the nucleus and the cytoplasm and binds in vivo to poly(A)+ R. NXF1 overcomes the mR export block caused by the presence of saturating amounts of CTE (constitutive transport element) R of type D retroviruses.This gene is one member of a family of nuclear R export factor genes. Common domain features of this family are a noncanonical RNP-type R-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Altertive splicing seems to be a common mechanism in this gene family. The encoded protein of this gene shuttles between the nucleus and the cytoplasm and binds in vivo to poly(A)+ R. It is the vertebrate homologue of the yeast protein Mex67p. The encoded protein overcomes the mR export block caused by the presence of saturating amounts of CTE (constitutive transport element) R of type D retroviruses.This gene is one member of a family of nuclear R export factor genes. Common domain features of this family are a noncanonical RNP-type R-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Altertive splicing seems to be a common mechanism in this gene family. The encoded protein of this gene shuttles between the nucleus and the cytoplasm and binds in vivo to poly(A)+ R. It is the vertebrate homologue of the yeast protein Mex67p. The encoded protein overcomes the mR export block caused by the presence of saturating amounts of CTE (constitutive transport element) R of type D retroviruses.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NXF1 (4 products)

Catalog No. Species Pres. Purity   Source  

NXF1

NXF1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NXF1

NXF1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NXF1

NXF1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NXF1

NXF1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for NXF1 (1 products)

Catalog No. Species Pres. Purity   Source  

NXF1 Lysate

Western Blot: NXF1 Lysate [NBL1-13888] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NXF1
  Novus Biologicals Inc.
  • LinkedIn