TA345963 RNASEH2A antibody

Rabbit Polyclonal Anti-RNASEH2A Antibody

See related secondary antibodies

Search for all "RNASEH2A"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rat, Yeast, Zebrafish RNASEH2A

TA345963

More Views

  • TA345963

Product Description for RNASEH2A

Rabbit anti Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rat, Yeast, Zebrafish RNASEH2A.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for RNASEH2A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AGS4, Aicardi-Goutieres syndrome 4 protein, RNASEHI, RNAse H2A, RNHIA, RNase H2 subunit A, RNase HI large subunit, Ribonuclease H2 subunit A, Ribonuclease HI large subunit, Ribonuclease HI subunit A
Presentation Purified
Reactivity Bov, Can, Eq, Gt, Hu, Ms, Por, Rt, Ye, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75792
Immunogen:
The immunogen for anti-RNASEH2A antibody: synthetic peptide directed towards the middle region of human RNASEH2A. Synthetic peptide located within the following region: AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE.
GeneID:
10535
Application WB
IHC
Background Of the multiple Rses H in mammals, Rse HI is the major enzyme and shows increased activity during D replication. It shows more homology to the Rse HII of Escherichia coli.Of the multiple Rses H in mammals, Rse HI is the major enzyme and shows increased activity during D replication. It shows more homology to the Rse HII of Escherichia coli.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RNASEH2A (5 products)

Catalog No. Species Pres. Purity   Source  

RNASEH2A

RNASEH2A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RNASEH2A (1-299, His-tag)

RNASEH2A Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €1,070.00
  OriGene Technologies GmbH

RNASEH2A (1-299, His-tag)

RNASEH2A Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €400.00
  OriGene Technologies GmbH

RNASEH2A

RNASEH2A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RNASEH2A

RNASEH2A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RNASEH2A (2 products)

Catalog No. Species Pres. Purity   Source  

RNASEH2A 293T Cell Transient Overexpression Lysate(Denatured)

RNASEH2A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RNASEH2A overexpression lysate

RNASEH2A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn