TA345973 IGF2BP3 / IMP3 antibody

Rabbit Polyclonal Anti-Igf2bp3 Antibody

See related secondary antibodies

Search for all "IGF2BP3 / IMP3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast IGF2BP3 / IMP3

Product Description for IGF2BP3 / IMP3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast IGF2BP3 / IMP3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IGF2BP3 / IMP3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms IGF-II mRNA-binding protein 3, Insulin-like growth factor 2 mRNA-binding protein 3, KH domain-containing protein overexpressed in cancer, KOC1, VICKZ family member 3, VICKZ3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9CPN8
Immunogen:
The immunogen for anti-Igf2bp3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QQNPSPQLRGRRGPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAI.
GeneID:
140488
Application WB
Background Igf2bp3 is a R-binding protein that act as a regulator of mR translation and stability. Igf2bp3 binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRs. Igf2bp3 binds to sequences in the 3'-UTR of CD44 mR.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn