TA345983 SURF6 antibody

Rabbit Polyclonal Anti-SURF6 Antibody

See related secondary antibodies

Search for all "SURF6"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rat SURF6

TA345983

More Views

  • TA345983
  • TA345983

Product Description for SURF6

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rat SURF6.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SURF6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SURF-6, Surfeit locus protein 6
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75683
Immunogen:
The immunogen for anti-SURF6 antibody: synthetic peptide directed towards the middle region of human SURF6. Synthetic peptide located within the following region: EPREPPGLIFNKVEVSEDEPASKAQRRKEKRQRVKGNLTPLTGRNYRQLL.
GeneID:
6838
Application WB
IHC
Background This gene is located in the surfeit gene cluster, a group of very tightly linked genes that do not share sequence similarity. The gene demonstrates features of a housekeeping gene, being ubiquitously expressed, and the encoded protein has been localized to the nucleolus. The protein includes motifs found in both the mouse and fish orthologs, which suggests a putative function as a nucleolar-matrix protein with nucleic acid-binding properties, based on characteristics determined in mouse.This gene is located in the surfeit gene cluster, a group of very tightly linked genes that do not share sequence similarity. The gene demonstrates features of a housekeeping gene, being ubiquitously expressed, and the encoded protein has been localized to the nucleolus. The protein includes motifs found in both the mouse and fish orthologs, which suggests a putative function as a nucleolar-matrix protein with nucleic acid-binding properties, based on characteristics determined in mouse.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SURF6 (2 products)

Catalog No. Species Pres. Purity   Source  

SURF6

SURF6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SURF6

SURF6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for SURF6 (2 products)

Catalog No. Species Pres. Purity   Source  

SURF6 293T Cell Transient Overexpression Lysate(Denatured)

SURF6 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SURF6 overexpression lysate

SURF6 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn