TA345989 SFRS1 (SF2) antibody

Rabbit Polyclonal Anti-SFRS1 Antibody

See related secondary antibodies

Search for all "SFRS1 (SF2)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat, Zebrafish SFRS1 (SF2)

Product Description for SFRS1 (SF2)

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat, Zebrafish SFRS1 (SF2).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SFRS1 (SF2)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ASF, ASF-1, Alternative-splicing factor 1, SF2P33, Splicing factor arginine/serine-rich 1, pre-mRNA-splicing factor SF2 P33 subunit
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q07955
Immunogen:
The immunogen for anti-SFRS1 antibody: synthetic peptide directed towards the C terminal of human SFRS1. Synthetic peptide located within the following region: EFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR.
GeneID:
6426
Application WB
Background SFRS1 is a member of the arginine/serine-rich splicing factor protein family, and functions in both constitutive and altertive pre-mR splicing. The protein binds to pre-mR transcripts and components of the spliceosome, and can either activate or repress splicing depending on the location of the pre-mR binding site. The protein's ability to activate splicing is regulated by phosphorylation and interactions with other splicing factor associated proteins. Multiple transcript variants encoding different isoforms have been found for this gene.Altertive mR splicing plays an important role in development and differentiation; many transcripts are spliced differently in distinct cell types and tissues. Both constitutive and altertive splicing occurs on spliceosomes, which are complex particles composed of small nuclear ribonucleoproteins (snRNPs) and non-snRNP proteins. The SR family of non-snRNP splicing factors is characterized by the presence of an R recognition motif and a serine- and arginine-rich (SR) domain. SR proteins are required at early stages of spliceosome assembly, have distinct but overlapping specificities for different pre-mRs, and can alter splice site choice, suggesting that they may be involved in the regulation of altertive splicing in vivo. Two of the SR proteins, ASF/SF2 (SFRS1) and SC35 (SFRS2; MIM 600813), have been extensively characterized.Altertive mR splicing plays an important role in development and differentiation; many transcripts are spliced differently in distinct cell types and tissues. Both constitutive and altertive splicing occurs on spliceosomes, which are complex particles composed of small nuclear ribonucleoproteins (snRNPs) and non-snRNP proteins. The SR family of non-snRNP splicing factors is characterized by the presence of an R recognition motif and a serine- and arginine-rich (SR) domain. SR proteins are required at early stages of spliceosome assembly, have distinct but overlapping specificities for different pre-mRs, and can alter splice site choice, suggesting that they may be involved in the regulation of altertive splicing in vivo. Two of the SR proteins, ASF/SF2 (SFRS1) and SC35 (SFRS2; MIM 600813), have been extensively characterized (Bermingham et al., 1995).[supplied by OMIM].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SFRS1 (SF2) (5 products)

Catalog No. Species Pres. Purity   Source  

SFRS1 (SF2) (transcript variant 1)

SFRS1 (SF2) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SFRS1 (SF2) (1-248, His-tag)

SFRS1 (SF2) Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

SFRS1 (SF2) (1-248, His-tag)

SFRS1 (SF2) Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

SFRS1 (SF2)

SFRS1 (SF2) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SFRS1 (SF2)

SFRS1 (SF2) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for SFRS1 (SF2) (2 products)

Catalog No. Species Pres. Purity   Source  

SF2 Lysate

Western Blot: SF2 Lysate [NBL1-15886] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for SFRS1.
  Novus Biologicals Inc.

SFRS1 293T Cell Transient Overexpression Lysate(Denatured)

SFRS1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn