TA346048 Carbonic anhydrase 4 antibody

Rabbit Polyclonal Anti-CA4 Antibody

See related secondary antibodies

Search for all "Carbonic anhydrase 4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Carbonic anhydrase 4

Product Description for Carbonic anhydrase 4

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Carbonic anhydrase 4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Carbonic anhydrase 4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CA-IV, CA4, Carbonate dehydratase IV, Carbonic anhydrase IV
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P22748
Immunogen:
The immunogen for anti-CA4 antibody: synthetic peptide directed towards the C terminal of human CA4. Synthetic peptide located within the following region: AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG.
GeneID:
762
Application WB
Background Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospil fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA4 is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the lumil surfaces of pulmory (and certain other) capillaries and of proximal rel tubules. Its exact function is not known, however, it may have a role in inherited rel abnormalities of bicarbote transport.Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospil fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the lumil surfaces of pulmory (and certain other) capillaries and of proximal rel tubules. Its exact function is not known, however, it may have a role in inherited rel abnormalities of bicarbote transport.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Carbonic anhydrase 4 (6 products)

Catalog No. Species Pres. Purity   Source  

Carbonic anhydrase 4

Carbonic anhydrase 4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Carbonic anhydrase 4

Carbonic anhydrase 4 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €299.00
  OriGene Technologies, Inc.

Carbonic anhydrase 4

Carbonic anhydrase 4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Carbonic anhydrase 4

Carbonic anhydrase 4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Carbonic anhydrase 4

Carbonic anhydrase 4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Carbonic anhydrase 4

Carbonic anhydrase 4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Carbonic anhydrase 4 (2 products)

Catalog No. Species Pres. Purity   Source  

CA4 293T Cell Transient Overexpression Lysate(Denatured)

CA4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CA4 overexpression lysate

CA4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn