TA346052 Folate receptor alpha antibody

Rabbit Polyclonal Anti-FOLR1 Antibody

See related secondary antibodies

Search for all "Folate receptor alpha"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Folate receptor alpha

TA346052

More Views

  • TA346052
  • TA346052

Product Description for Folate receptor alpha

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Folate receptor alpha.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Folate receptor alpha

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Adult folate-binding protein, FOLR, FOLR1, FR-alpha, Folate receptor 1, KB cells FBP, MOv18, Ovarian tumor-associated antigen MOv18
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P15328
Immunogen:
The immunogen for anti-FOLR1 antibody: synthetic peptide directed towards the middle region of human FOLR1. Synthetic peptide located within the following region: HFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARF.
GeneID:
2348
Application WB
Background The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells. This gene product is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Folate receptor alpha (4 products)

Catalog No. Species Pres. Purity   Source  

Folate receptor alpha (25-234, His-tag)

Folate receptor alpha Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

Folate receptor alpha (25-234, His-tag)

Folate receptor alpha Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

Folate receptor alpha

Folate receptor alpha Human in vitro transl.
  Abnova Taiwan Corp.

Folate receptor alpha

Folate receptor alpha Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Folate receptor alpha (2 products)

Catalog No. Species Pres. Purity   Source  

Folate Binding Protein Lysate

Western Blot: Folate Binding Protein Lysate [NBL1-10790] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for FOLR1.
  Novus Biologicals Inc.

FOLR1 293T Cell Transient Overexpression Lysate(Denatured)

FOLR1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn