TA346060 SLC13A3 / NADC3 antibody

Rabbit Polyclonal Anti-SLC13A3 Antibody

See related secondary antibodies

Search for all "SLC13A3 / NADC3"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish SLC13A3 / NADC3

Product Description for SLC13A3 / NADC3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish SLC13A3 / NADC3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC13A3 / NADC3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Na(+)/dicarboxylate cotransporter 3, NaDC-3, SDCT2, Sodium-dependent high-affinity dicarboxylate transporter 2, Solute carrier family 13 member 3, hNaDC3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WWT9
Immunogen:
The immunogen for anti-SLC13A3 antibody: synthetic peptide directed towards the N terminal of human SLC13A3. Synthetic peptide located within the following region: MAVYWCTEALPLSVTALLPIVLFPFMGILPSNKVCPQYFLDTNFLFLSGL.
GeneID:
64849
Application WB
Background Mammalian sodium-dicarboxylate cotransporters transport succite and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. SLC13A3 represents the high-affinity form.Mammalian sodium-dicarboxylate cotransporters transport succite and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. The protein encoded by this gene represents the high-affinity form. Altertively spliced transcript variants encoding different isoforms have been found for this gene, although the full-length ture of some of them have not been characterized yet.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SLC13A3 / NADC3 (4 products)

Catalog No. Species Pres. Purity   Source  

SLC13A3 / NADC3

SLC13A3 / NADC3 Human Purified
  Abnova Taiwan Corp.

SLC13A3 / NADC3

SLC13A3 / NADC3 Human Purified
  Abnova Taiwan Corp.

SLC13A3 / NADC3

SLC13A3 / NADC3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SLC13A3 / NADC3

SLC13A3 / NADC3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SLC13A3 / NADC3 (1 products)

Catalog No. Species Pres. Purity   Source  

SLC13A3 293T Cell Transient Overexpression Lysate(Denatured)

SLC13A3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn