TA334518 PPIL2 antibody

Rabbit Polyclonal Anti-PPIL2 Antibody

See related secondary antibodies

Search for all "PPIL2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat PPIL2

Product Description for PPIL2

Rabbit anti Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat PPIL2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PPIL2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cyclophilin 60, Cyclophilin-like protein Cyp-60, Peptidyl-prolyl cis-trans isomerase-like 2, Rotamase PPIL2
Presentation Purified
Reactivity Can, Eq, GP, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13356
Immunogen:
The immunogen for anti-PPIL2 antibody: synthetic peptide directed towards the C terminal of human PPIL2. Synthetic peptide located within the following region: GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ.
GeneID:
23759
Application WB
Background PPIL2 is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. This protein interacts with the proteise inhibitor eglin c and is localized in the nucleus. This gene is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. This protein interacts with the proteise inhibitor eglin c and is localized in the nucleus. Multiple transcript variants encoding different isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PPIL2 (6 products)

Catalog No. Species Pres. Purity   Source  

PPIL2 (1-527, His-tag)

PPIL2 Human Purified > 95 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

PPIL2 (1-527, His-tag)

PPIL2 Human Purified > 95 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

PPIL2

PPIL2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PPIL2

PPIL2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PPIL2

PPIL2 Human
  Abnova Taiwan Corp.

PPIL2

SDS-Page: PPIL2 Protein [NBP1-41225] - PPIL2, 61.6 kDa (547aa) with a purity of 95% by SDS - PAGE
  Novus Biologicals Inc.

Positive controls for PPIL2 (3 products)

Catalog No. Species Pres. Purity   Source  

PPIL2 293T Cell Transient Overexpression Lysate(Denatured)

PPIL2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PPIL2 Lysate

Western Blot: PPIL2 Lysate [NBL1-14652] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PPIL2
  Novus Biologicals Inc.

PPIL2 overexpression lysate

PPIL2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn