TA342217 Complex I subunit NDUFS3 antibody

Rabbit polyclonal Anti-NDUFS3 Antibody

See related secondary antibodies

Search for all "Complex I subunit NDUFS3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Porcine, Rabbit, Rat Complex I subunit NDUFS3

Product Description for Complex I subunit NDUFS3

Rabbit anti Bovine, Canine, Human, Porcine, Rabbit, Rat Complex I subunit NDUFS3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Complex I subunit NDUFS3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Complex I-30kD, Mitochondria Complex I (NADH Dehydrogenase), NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, NADH-ubiquinone oxidoreductase 30 kDa subunit, mitochondrial
Presentation Purified
Reactivity Bov, Can, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75489
Immunogen:
The immunogen for anti-NDUFS3 antibody: synthetic peptide directed towards the middle region of human NDUFS3. Synthetic peptide located within the following region: EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK.
GeneID:
4722
Application WB
Background This gene encodes one ofThe iron-sulfur protein (IP) components of mitochondrial DH:ubiquinone oxidoreductase (complex I). Mutations inThis gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.[provided by RefSeq, Apr 2009].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Complex I subunit NDUFS3 (8 products)

Catalog No. Species Pres. Purity   Source  

Complex I subunit NDUFS3 (37-264, His-tag)

Complex I subunit NDUFS3 Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €820.00
  OriGene Technologies GmbH

Complex I subunit NDUFS3 (37-264, His-tag)

Complex I subunit NDUFS3 Human Purified > 85 % by SDS - PAGE E. coli
10 µg / €320.00
  OriGene Technologies GmbH

Complex I subunit NDUFS3

Complex I subunit NDUFS3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Complex I subunit NDUFS3

Complex I subunit NDUFS3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Complex I subunit NDUFS3

Complex I subunit NDUFS3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Complex I subunit NDUFS3

Complex I subunit NDUFS3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Complex I subunit NDUFS3

Complex I subunit NDUFS3 Human Purified 95 % E. coli
  GenWay Biotech Inc.

Complex I subunit NDUFS3

Complex I subunit NDUFS3 Human Purified 95 % E. coli
  GenWay Biotech Inc.

Positive controls for Complex I subunit NDUFS3 (3 products)

Catalog No. Species Pres. Purity   Source  

NDUFS3 293T Cell Transient Overexpression Lysate(Denatured)

NDUFS3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NDUFS3 Lysate

Western Blot: NDUFS3 Lysate [NBL1-13562] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NDUFS3
  Novus Biologicals Inc.

NDUFS3 overexpression lysate

NDUFS3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn